Bacterial taxon 155864
Locus Z3278
Protein AAG57171.1
putative chaperone protein
Escherichia coli O157:H7 str. EDL933
Length 240 aa, Gene n/a, UniProt n/a
>AAG57171.1|Escherichia coli O157:H7 str. EDL933|putative chaperone protein
MAAIFMAASINIRGIKMKGLLSLXISSMIFPAHAGMVIFGTRIIYPAEQKEVMVQLMNQGNRSSLMQAWIDDGDTSLPPEKIQVPFMLTPPVVKVAANSGQQIKIKIMPNKLPSNKESIFYLNVLDIPPNSPEDEGKNALKFAMQNRIKLFYRPAGIAPVNKTTFKKLRVSRSGNNVVIKNDSPNWVTISDVKANNVKVNYETIMIAPQESQNVSEKNNNANGWQLTIIDDHGNYISDKI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,937,519 | -3.3 | 0.11 | ●○○○○ -0.99 | -0.9912239594322548 | 21278291 |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)