Bacterial taxon 155864
Locus Z3219
Protein AAG57115.1
putative colanic acid biosynthesis glycosyl transferase
Escherichia coli O157:H7 str. EDL933
Length 248 aa, Gene n/a, UniProt n/a
>AAG57115.1|Escherichia coli O157:H7 str. EDL933|putative colanic acid biosynthesis glycosyl transferase
MLLSIITVAFRNLEGIVKTHASLAHLAQAEDISFEWIVVDGGSNDGTREYLENLNGIYNLRFVSEPDNGIYDAMNKGIAMAQGKFALFLNSGDIFHQDAAYFVRKLKMQKDNVMITGDALLDFGDGHKIKRSAKPGWYIYHSLPASHQAIFFPVSGLKKWRYDLEYKVSSDYALAAKMYKAGYAFKKLNGLVSEFSMGGVSTTNNMELCADAKKVQRQILHVPGFWAELSWHLRQRTTSKTKALYNKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,875,204 | -0.61 | 0.17 | ○○○○○ 0.21 | 0.20929043618918944 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,875,170 | 1.48 | 0.092 | ○○○○○ 1.15 | 1.1483585437119737 | 21278291 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)