Bacterial taxon 155864
Locus Z0424
Protein AAG54677.1
putative cytochrome subunit of dehydrogenase
Escherichia coli O157:H7 str. EDL933
Length 223 aa, Gene n/a, UniProt n/a
>AAG54677.1|Escherichia coli O157:H7 str. EDL933|putative cytochrome subunit of dehydrogenase
MMQLVHLFMDEITMDPLHAVYLTVGLFVITFFNPGANLFVVVQTSLASGRRAGVLTGLGVALGDAFYSGLGLFGLATLITQCEEIFSLIRIVGGAYLLWFAWCSMRRQSTPQMSTLQQPINAPWYVFFRRGLITDLSNPQTVLFFISIFSVTLNAETPTWARLMAWAGIVLASIIWRVFLSQAFSLPAVRRAYGRMQRVASRVIGAIIGVFALRLIYEGVTQR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 402,742 | 1.4 | 0.096 | ○○○○○ 1.11 | 1.1115165627215242 | 21278291 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)