Bacterial taxon 155864
Locus Z4333
Protein AAG58117.1
putative cytotoxin
Escherichia coli O157:H7 str. EDL933
Length 275 aa, Gene n/a, UniProt n/a
>AAG58117.1|Escherichia coli O157:H7 str. EDL933|putative cytotoxin
MIKLQDNFFNYCIVKGVTEINDELRINYLKNVIKLSDDDIGNYQKTINDNKDRVKKLILDLQKQFGENRISIKDVNSLTSLSKSENNHNYQTEMLLRWNYPAASDLLRMYILKEHGGIYTDTDMMPAYSKQVIFKIMMQTNGDNRFLEDLKLRRAISDGVLRYVNNQNIDEVNYNEISDADKNIIKKILTEISKMPEDSIFTKINTRIPRDTMPILRRYHLWPDGWNIRGLNGFMLSHKGSEVIDAVIAGQNQAYRELRRIRDNIHSEIYFKQTD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,936,138 | -0.8 | 0.18 | ○○○○○ 0.12 | 0.12484494425377954 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,936,128 | 0.62 | 0.13 | ○○○○○ 0.76 | 0.7610015549926926 | 21278291 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)