Bacterial taxon 155864
Locus Z2120
Protein AAG56190.1
putative endolysin of prophage CP-933O
Escherichia coli O157:H7 str. EDL933
Length 177 aa, Gene n/a, UniProt n/a
>AAG56190.1|Escherichia coli O157:H7 str. EDL933|putative endolysin of prophage CP-933O
MNEKIKYGLSAAVLALIGAGASAPEILDQFLDEKEGNHTTAYRDGAGIWTICRGAILVDGKPVIPGMKLSKEKCDRVNAIERDKALAWVEKNIRVPLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWDIDR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,904,482 | 0.55 | 0.14 | ○○○○○ 0.73 | 0.7303694871890384 | 21278291 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)