Bacterial taxon 155864
Locus Z1879
Protein AAG55976.1
putative envelope protein of prophage CP-933X
Escherichia coli O157:H7 str. EDL933
Length 150 aa, Gene n/a, UniProt n/a
>AAG55976.1|Escherichia coli O157:H7 str. EDL933|putative envelope protein of prophage CP-933X
MQTTRPRITWKVLPMAQVAIFKEIFDQVRKDLNCELFYSELKRHNVSHYIYYLATDNIHIVLENDNTVLIKGLKKVVNVKFSRNTHLIETSYDRLKSREITFQQYRENLAKAGVFRWVTNIHEHKRYYYAFDNSLLFTESIQNTTQIFPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,712,847 | 0.93 | 0.12 | ○○○○○ 0.9 | 0.9025621657672384 | 21278291 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)