Bacterial taxon 155864
Locus Z5052
Protein AAG58772.1
putative LPS biosynthesis protein
Escherichia coli O157:H7 str. EDL933
Length 235 aa, Gene n/a, UniProt n/a
>AAG58772.1|Escherichia coli O157:H7 str. EDL933|putative LPS biosynthesis protein
MIYNKTINGVKVFIKDNDPFYEQVLNDFLTCRVKTLKVFRSIDDTKVILIDTARGPLVLKVYAPKHKMTERFLKSCIKKDYYENLIYQTDRVRGEGIQSINDYFLLAERKTLNFAHYYIMLIEYIEGVGLNEYLEISEDLKDQLSESIKELHQHGMVSGDPHKGNFIVSEKGLRLIDLSGKKTTAVLKAKDRIDLERHYNIKNELKDFGYTYLIFKKKIKKVIRDVKVKLGLKSK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,616,753 | -5.88 | 0.018 | ●●●○○ -2.15 | -2.146329542720398 | 21278291 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)