Bacterial taxon 155864
Locus Z0342
Protein AAG54601.1
putative LysR-like transcriptional regulator
Escherichia coli O157:H7 str. EDL933
Length 299 aa, Gene n/a, UniProt n/a
>AAG54601.1|Escherichia coli O157:H7 str. EDL933|putative LysR-like transcriptional regulator
MKIDLNLLPIFIAVAEESNFSKAAARLGVTRSAVSQGIRRLEDAFGTMLVMRTTRSVNLTEAGERLHKSLSLPLSGIEAAFEEMVSDHVPRGLLRIAVTSIAEEFLSGPLIASFAAANPAVTLDIVVTDEEFDIVAAGYDAGVRLGEVIEKDMIAVPLTGRQREMVVASPSYLAANSTPVHPRELVNHKCIGWRQSPEVAPYRWPFEENGRAFDLAIEPQITTNDLRLMLRLALAGGGITIATQETFRPYIESGKLVSLLDDFLPQFPGFYLYFPQRRNIAPKLRALIDHVKEWRQQLA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 323,711 | -3.56 | 0.096 | ●●○○○ -1.11 | -1.1098667366313753 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 324,482 | -0.41 | 0.17 | ○○○○○ 0.3 | 0.2996983984227525 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 323,707 | 0.48 | 0.14 | ○○○○○ 0.7 | 0.6973628541976785 | 21278291 |
Retrieved 3 of 3 entries in 0.9 ms
(Link to these results)