Bacterial taxon 155864
Locus Z5225
Protein AAG58930.1
putative major fimbrial subuit
Escherichia coli O157:H7 str. EDL933
Length 200 aa, Gene n/a, UniProt n/a
>AAG58930.1|Escherichia coli O157:H7 str. EDL933|putative major fimbrial subuit
MKPNMIVGALALTSVFMAGHLQAADGTVHFRGEIIDSTCEVTPETKDQVVDLGKVNRTAFSGVDDVAAPTAFSIDLTQCPETFKSAAIRFDGNEDAHGNGNLAIGTPLDNSNDAAAGISPSDNSGDYTGAGAVSAAKGVAIRLYNRADNTQVKLYENSASTPISNGNASMKFMARYIATETTIDPGTANADSQFTVEYIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,773,383 | -0.5 | 0.17 | ○○○○○ 0.26 | 0.26236006381674415 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,773,445 | 0.13 | 0.15 | ○○○○○ 0.54 | 0.5442330157523669 | 21278291 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)