Bacterial taxon 155864
Locus Z2200
Protein AAG56260.1
putative major fimbrial subunit
Escherichia coli O157:H7 str. EDL933
Length 187 aa, Gene n/a, UniProt n/a
>AAG56260.1|Escherichia coli O157:H7 str. EDL933|putative major fimbrial subunit
MKLKHVGMIVVSVLAMSSAAVSAAEGDESVTTTVNGGVIHFKGEVVNAACAIDSESMNQTVELGQVRSSRLAKAGDLSSAVGFNIKLNDCDTNVSSNAAVAFLGTTVTSNDDTLALQSSAAGSAQNVGIQILDRTGEVLILDGATFSAKTDLIDGTNILPFQARYIALGQSVAGTANADATFKVQYL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,974,383 | 1.33 | 0.1 | ○○○○○ 1.08 | 1.0816482472592333 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,974,267 | 1.57 | 0.088 | ○○○○○ 1.19 | 1.1882632318786548 | 21278291 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)