Bacterial taxon 155864
Locus Z3597
Protein AAG57463.1
putative minor fimbrial subunit
Escherichia coli O157:H7 str. EDL933
Length 156 aa, Gene n/a, UniProt n/a
>AAG57463.1|Escherichia coli O157:H7 str. EDL933|putative minor fimbrial subunit
MKRISLLMLWSFSFMALSNVSFHGYLVQPPNCSISNGQNIELTFRDVNIDDINGSNYEQVVPYTITCDTAVRDPQMEMTLTWSGTQSDFDDSAVATDLNGLGIHLKQAGSDFKLHTPLVVNETSLPVLTAVPVKKSGVDLPESDFEAWATLQVDYQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,247,174 | 0.83 | 0.12 | ○○○○○ 0.86 | 0.857922795837654 | 21278291 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)