Bacterial taxon 155864
Locus Z0052
Protein AAG54349.1
putative NAD(P)H oxidoreductase
Escherichia coli O157:H7 str. EDL933
Length 176 aa, Gene n/a, UniProt n/a
>AAG54349.1|Escherichia coli O157:H7 str. EDL933|putative NAD(P)H oxidoreductase
MILIIYAHPYPHHSHANKRMFEQARTLEGVEIRSLYQLYPDFNIDIAAEQEALSRADLIVWQHPMQWYSIPPLLKLWIDKVFSHGWAYGHGGTALHGKHLLWAVTTGGGESHFEIGAHPGFDVLSQPLQATAIYCGLNWLPPFAMHCTFICDDETLEGQARHYKQRLLEWQEAHHG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 52,126 | -3.46 | 0.1 | ●●○○○ -1.06 | -1.0625823856891654 | 21278291 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)