Bacterial taxon 155864
Locus Z1489
Protein AAG55610.1
putative outer membrane protein Lom precursor of bacteriophage BP-933W
Escherichia coli O157:H7 str. EDL933
Length 244 aa, Gene n/a, UniProt n/a
>AAG55610.1|Escherichia coli O157:H7 str. EDL933|putative outer membrane protein Lom precursor of bacteriophage BP-933W
MKSIATLVVCAISGIACVNLSAHAAEGEHTISLGYAHFQFPGLKDFVKDATAHNRETFSHFVNRNYFSSLGEYTDGRVSGYEGKDKNPQGINIRYRYEITDDFGVITSFTWTRSLTNSQTFIDVQSADHTRKIKNPAASARTDIRANYWSLLAGPSWRVNQYMSLYAMAGMGVAKVSADLKIKDNINSSGGFSESNSTKKTSLAWAAGAQFNLNESVTLDVAYEGSGSGDWRTSGVTAGIGLKF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,375,673 | -0.82 | 0.18 | ○○○○○ 0.12 | 0.116785022800409 | 21278291 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)