Bacterial taxon 155864
Locus Z4321
Protein AAG58105.1
putative PagC-like membrane protein
Escherichia coli O157:H7 str. EDL933
Length 177 aa, Gene n/a, UniProt n/a
>AAG58105.1|Escherichia coli O157:H7 str. EDL933|putative PagC-like membrane protein
MSGSRLADNHTLSAGYAQSKVQDFKNIKGVNLQYRYEWDSPVSVVGSFSYMKGDWADSHRDEADDFYRHQADIKYYSFLAGPAYRLNDYISFYGLVGISHTKAKGDYEWRNSVGADESDGYLSESVSKKSTDFAYAAGVIINPWGNMSVNVGYEGTKADIYGKHSVNGFTVGVGYRF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,925,233 | 0.08 | 0.16 | ○○○○○ 0.52 | 0.5206284617531384 | 21278291 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)