Bacterial taxon 155864
Locus Z3631
Protein AAG57494.1
putative positive transcription regulator (sensor EvgS)
Escherichia coli O157:H7 str. EDL933
Length 204 aa, Gene n/a, UniProt n/a
>AAG57494.1|Escherichia coli O157:H7 str. EDL933|putative positive transcription regulator (sensor EvgS)
MNAXIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETLKPDIVIIDVDIPGVNGIQVLETLRKRQYSGIIIIVSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNGYCYFPFSLNRFVGSLTSDQQKLDSLSKQEISVMRYILDGKDNNDIAEKMFISNKTVSTYKSRLMEKLECKSLMDLYTFAQRNKIG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,282,031 | -2.59 | 0.14 | ●○○○○ -0.67 | -0.6745416058244321 | 21278291 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)