Bacterial taxon 155864
Locus Z1786
Protein AAG55890.1
putative Q antiterminator of prophage CP-933N
Escherichia coli O157:H7 str. EDL933
Length 123 aa, Gene n/a, UniProt n/a
>AAG55890.1|Escherichia coli O157:H7 str. EDL933|putative Q antiterminator of prophage CP-933N
MARDIQMVLERWGAWAANNHEDVTWPSIAAGFKGLIPTKVKSRPKCSDDDAMIICGCMARLNKNNQYLHDLLVDYYVGGMTFMALARKHRCSDGLIGKRLYKAEGIIEGMLMALNVRLDMDMR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,638,325 | 0.24 | 0.15 | ○○○○○ 0.59 | 0.5927054439432125 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,638,568 | 0.74 | 0.13 | ○○○○○ 0.82 | 0.8169798777575173 | 21278291 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)