Bacterial taxon 155864
Locus Z0361
Protein AAG54619.1
putative regulator
Escherichia coli O157:H7 str. EDL933
Length 196 aa, Gene n/a, UniProt n/a
>AAG54619.1|Escherichia coli O157:H7 str. EDL933|putative regulator
MTWQNDYSRDYEVENHMECQNRSDKYIWSPHDAYFYKGLSELIVDIDRLIYLSLEKIRKDFVFINLNTDSLTEFINRDNEWLSAVKGKQVVLIAARKSEALANYWYYNSNIRGVVYAGLSRDIRKELAYVINGRFLRKDIKKDKITDREMEIIRMTAQGMLPKSIARIENCSVKTVYTHRRNAEAKLYSKLYKLVQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 343,650 | -4.35 | 0.061 | ●●○○○ -1.46 | -1.4617777471427158 | 21278291 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)