Bacterial taxon 155864
Locus Z2948
Protein AAG56884.1
putative regulator
Escherichia coli O157:H7 str. EDL933
Length 142 aa, Gene n/a, UniProt n/a
>AAG56884.1|Escherichia coli O157:H7 str. EDL933|putative regulator
MSYSNILVAVAVTPESQQLLAKAVSIARPVKGHISLITLASDPEMYNQLAAPMLEDLRSVMQEETQSFLDKLIQDAGYPVDKTFIAYGELSEHILEVCRKYHFDLVICGNHNHSFFSRASCSAKRVIASSEVDVLLVPLTGD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,656,498 | -2.01 | 0.16 | ●○○○○ -0.42 | -0.4163120014971173 | 21278291 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)