Bacterial taxon 155864
Locus Z5616
Protein AAG59217.1
putative sorbose PTS component
Escherichia coli O157:H7 str. EDL933
Length 164 aa, Gene n/a, UniProt n/a
>AAG59217.1|Escherichia coli O157:H7 str. EDL933|putative sorbose PTS component
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVVNIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIGTLNIGGMAWRPGKKQLTKAVSLDDDDINAFHELNNLGVILDLRVVASDPSINIIYKINEQLIAN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,110,709 | -0.43 | 0.17 | ○○○○○ 0.29 | 0.2920540339991188 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,111,098 | 1.08 | 0.11 | ○○○○○ 0.97 | 0.9669507112846348 | 21278291 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)