Bacterial taxon 155864
Locus Z3362
Protein AAG57245.1
putative superinfection exclusion protein B of prophage CP-933V
Escherichia coli O157:H7 str. EDL933
Length 153 aa, Gene n/a, UniProt n/a
>AAG57245.1|Escherichia coli O157:H7 str. EDL933|putative superinfection exclusion protein B of prophage CP-933V
MNNSWWQELMHFFLQGMTLKQLIHMLIILIILIIVMPVSVKEWINLHNPEILPHYWMYYILLFCVSYVLNGVVNSAYHAVTERIEIFAAQKRKSKEEKYVQDLFDSLTLGERAYLAFAVAANNQLKTEKGSPEAISLLEKGLLIRVPXCYWIS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,006,591 | -4.92 | 0.041 | ●●○○○ -1.72 | -1.7189776721911316 | 21278291 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)