Bacterial taxon 155864
Locus Z2144
Protein AAG56210.1
putative tail component of prophage CP-933O
Escherichia coli O157:H7 str. EDL933
Length 225 aa, Gene n/a, UniProt n/a
>AAG56210.1|Escherichia coli O157:H7 str. EDL933|putative tail component of prophage CP-933O
MATTNAFCLASPPLARICLHGDLQRFGRRLSLYVNTAAEAIRALSLQMPGFRRQMNEGWYQIRIRGEDTAPEAVYARLHEPLGEGAVIHIVPRLAGAGKGGLQIVLGAAAIVGSFFTAXATMALWGAALSAGGLTATTMLFSLGASMILGGVAQMLAPKAKTPEYRATDNGKQNTYFSSLDNMIAQGNPMPVPYGEMLVGSRRISQDISTRDEGGDGKVVVIGRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,921,177 | 1.11 | 0.11 | ○○○○○ 0.98 | 0.9832462005602888 | 21278291 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)