Bacterial taxon 155864
Locus Z3087
Protein AAG57003.1
putative tail fiber component V of prophage CP-933U
Escherichia coli O157:H7 str. EDL933
Length 250 aa, Gene n/a, UniProt n/a
>AAG57003.1|Escherichia coli O157:H7 str. EDL933|putative tail fiber component V of prophage CP-933U
MATPNPLEPVKGAGTTLWVYNGKGDAYANPLSDDDWQRLAKVKDLTPGEMTAEPYDDNYLDDEDADWTATGQGQKSAGDTSFTLAWKPGEEGQKGLIGWFESGDVRAYKIRFPNGTVDVFRGWVSSIGKAVTAKEVITRTVKVTNVGKPSVAEERSEITPATAIKVTPTSGTVAKGKTTTLTVSFEPESATDKTFRAVSADPSKATISVKDMTITVNGVATGKVQIPVVSGNGQFAAVAEVTVTEAGAAG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,758,401 | -0.38 | 0.17 | ○○○○○ 0.31 | 0.3138472539240685 | 21278291 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)