Bacterial taxon 155864
Locus Z2985
Protein AAG56917.1
putative tail fiber protein of prophage CP-933T
Escherichia coli O157:H7 str. EDL933
Length 164 aa, Gene n/a, UniProt n/a
>AAG56917.1|Escherichia coli O157:H7 str. EDL933|putative tail fiber protein of prophage CP-933T
MAMMMIYGMFVFELRTLPHQQLQQNKSWRHVKNERVNRSASWQYIGAGDDRIVLSGVLYPEITGGEVSLSLLTTQAYTGRPWPLIDGVGQIYGMYVLTGTNTTRSEFDRYGKAKKIEFSLTLERCDEDLRERLQSSSFSDMLSGFKDKVTSSLNSAASSVKGLL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,681,319 | 0.37 | 0.14 | ○○○○○ 0.65 | 0.652247822933143 | 21278291 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)