Bacterial taxon 155864
Locus Z3674
Protein AAG57527.1
putative transcriptional regulator LYSR-type
Escherichia coli O157:H7 str. EDL933
Length 184 aa, Gene n/a, UniProt n/a
>AAG57527.1|Escherichia coli O157:H7 str. EDL933|putative transcriptional regulator LYSR-type
MNYSLKQLKVFVTVAQEKSFSRAGERIGLSQSAVSHSVKELENHTGVRLLDRTTREVVLTDAGQQLALRLERLLDELNSTLRDTGRMGQQLSGKVRVAASQTISAHLIPQCIAESHRRYPDIQFVLHDRPQQWVMESIRQGDVDFGIVIDPGPVGDLQCEVILSEPFFLLCHRDSALAAEDYVP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,320,973 | 0.84 | 0.12 | ○○○○○ 0.86 | 0.8599884149328347 | 21278291 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)