Bacterial taxon 155864
Locus Z5926
Protein AAG59510.1
putative transcriptional regulator LYSR-type
Escherichia coli O157:H7 str. EDL933
Length 242 aa, Gene n/a, UniProt n/a
>AAG59510.1|Escherichia coli O157:H7 str. EDL933|putative transcriptional regulator LYSR-type
MTPLQLSEQGKIFHSQIRHLLQQLESNLAELRGGSDYAQRKIKIAAAHSLSLGLLPSIISQMPPLFTWAIEAIDVDEAVDKLREGQSDCIFSFHDEDLLEAPFDHIRLFESQLFPVCASDEHGEALFDLVQPHFPLLNYSRNSYMGRLINRTLTRHSELSFSTFFVSSMSELLKQVALDGCGIAWLPEYAIQQEIRSGQLVVLNRDELVIPIQAYAYRMNTRMNPVAERFWRELRELEIVLS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,442,549 | 1.74 | 0.08 | ○○○○○ 1.26 | 1.2644845477976274 | 21278291 |
Retrieved 1 of 1 entries in 0.3 ms
(Link to these results)