Bacterial taxon 155864
Locus Z3218
Protein AAG57114.1
putative transferase
Escherichia coli O157:H7 str. EDL933
Length 182 aa, Gene n/a, UniProt n/a
>AAG57114.1|Escherichia coli O157:H7 str. EDL933|putative transferase
MQDLSGFSVPKGFRGGNAIKVQLWWAVQATIFAWSPQVLYRWRAFLLRLFGAKIGKNVVIRPSVKITYPWKLTLGDYVWVGDDVNLYTLGEITIGAHSVISQKSYLCTGSHDHASQHFTINATPIVIGEKCWLATDVFVAPGVTIGDGTVVGARSSVFKSLPANVVCRGNPAVVIRKRVETE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,874,391 | -2.69 | 0.14 | ●○○○○ -0.72 | -0.7178351623676182 | 21278291 |
Retrieved 1 of 1 entries in 8.6 ms
(Link to these results)