Bacterial taxon 155864
Locus Z1035
Protein AAG55185.1
putative transmembrane subunit
Escherichia coli O157:H7 str. EDL933
Length 295 aa, Gene n/a, UniProt n/a
>AAG55185.1|Escherichia coli O157:H7 str. EDL933|putative transmembrane subunit
MPGSLRKMPVWLPIVILLVAMASIQGGASLAKSLFPLVGAPGVTALRLALGTLILIAFFKPWRLRFAKEQRLPLLFYGVSLGGMNYLFYLSIQTVPLGIAVALEFTGPLAVALFSSRRPVDFVWVVLAVLGLWFLLPLGQDVSHVDLTGCALALGAGACWAIYILSGQRAGAEHGPATVAIGSLIAALIFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 975,615 | 0.69 | 0.13 | ○○○○○ 0.79 | 0.7936232701728947 | 21278291 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)