Bacterial taxon 155864
Locus Z5815
Protein AAG59402.1
putative transposase
Escherichia coli O157:H7 str. EDL933
Length 138 aa, Gene n/a, UniProt n/a
>AAG59402.1|Escherichia coli O157:H7 str. EDL933|putative transposase
MKKETDIRRGRHCVFLMHVHLVFVTRYRRQIFDHDATEKLRTYFSKVCADFEAELVEMDGEPDHVHLLINYPPKLAISSLVNSLKGVSGRLLRRDRPDIAVRYYYKGVLWSPGYFASSCGGAPISAIRQYIEQQQTPG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 5,311,759 | -0.62 | 0.17 | ○○○○○ 0.21 | 0.20843346779344918 | 21278291 |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)