Bacterial taxon 155864
Locus Z0024
Protein AAG54323.1
putative type-1 fimbrial protein
Escherichia coli O157:H7 str. EDL933
Length 177 aa, Gene n/a, UniProt n/a
>AAG54323.1|Escherichia coli O157:H7 str. EDL933|putative type-1 fimbrial protein
MKKYIIPFVATTLMFSATTFAKDVDQGTLTIRGEVVDTTCYFVNGDSTTDIVVEDVVTSAMNQLINNEIYTLKTGSTSHDLEIQCDGNTAPSIEVLASEFDANNFTLNKGTAENIGFAIFLDDGTLTRMRPGLKTPLKDNGSGQYFLNLNAQYARTSGNPVTKGSVESTVTIKISAD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 22,854 | -1.73 | 0.17 | ●○○○○ -0.29 | -0.2922904249870902 | 21278291 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)