Bacterial taxon 155864
Locus Z4596
Protein AAG58365.1
repressor of arg regulon; cer-mediated site specific recombination
Escherichia coli O157:H7 str. EDL933
Length 156 aa, Gene n/a, UniProt n/a
>AAG58365.1|Escherichia coli O157:H7 str. EDL933|repressor of arg regulon; cer-mediated site specific recombination
MRSSAKQEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEGILGTIAGDDTIFTTPANGFTVKDLYEAILELFDQEL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,187,370 | -2.55 | 0.14 | ●○○○○ -0.66 | -0.6581810946449859 | 21278291 |
Retrieved 1 of 1 entries in 1.4 ms
(Link to these results)