Bacterial taxon 155864
Locus Z0009
Protein AAG54309.1
required for the efficient incorporation of molybdate into molybdoproteins
Escherichia coli O157:H7 str. EDL933
Length 195 aa, Gene n/a, UniProt n/a
>AAG54309.1|Escherichia coli O157:H7 str. EDL933|required for the efficient incorporation of molybdate into molybdoproteins
MNTLRIGLVSISDRASSGVYQDKGIPALEEWLTSALTTPFELETRLIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMRQISLHFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPYVETAPEVVAAFRPKSARRDVSE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 9,817 | 0.22 | 0.15 | ○○○○○ 0.58 | 0.5812950338812404 | 21278291 |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)