Bacterial taxon 155864
Locus Z1308
Protein AAG55444.1
suppressor of lon; inhibits cell division and ftsZ ring formation
Escherichia coli O157:H7 str. EDL933
Length 169 aa, Gene n/a, UniProt n/a
>AAG55444.1|Escherichia coli O157:H7 str. EDL933|suppressor of lon; inhibits cell division and ftsZ ring formation
MYTSGYAHRSSSFSSAASKIARVSTENTTAGLISEVVYREDQPMMTQLLLLPLLQQLGQQSRWQLWLTPQQKLSREWVQASGLPLTKVMQISQLSPCHTVESMVRALRTGNYSVVIGWLADDLTEEEHAELVDAANEGNAMGFIMRPVSASSHAXRQLSGLKIHSNLYH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,239,384 | -1.38 | 0.18 | ●○○○○ -0.13 | -0.13434168237928587 | 21278291 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)