Bacterial taxon 155864
Locus Z4187
Protein AAG57979.1
type III secretion apparatus protein
Escherichia coli O157:H7 str. EDL933
Length 150 aa, Gene n/a, UniProt n/a
>AAG57979.1|Escherichia coli O157:H7 str. EDL933|type III secretion apparatus protein
MGEVILYQLHSLLAATALGFCRLAPTFYLLPFFASGNIPTVVRHPIIIVVSCALVQHYHYELSTLNEIDIALLAAREIIIGLFIACLLASPFWIFLAIGSFIDNQRGATLSSTLDPATGVDTSELARLFNLFSAAVYLTNGGLNFILETL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,791,953 | -1.67 | 0.17 | ●○○○○ -0.26 | -0.26383798376870654 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,791,705 | 0.62 | 0.13 | ○○○○○ 0.76 | 0.762608720582267 | 21278291 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)