Bacterial taxon 155864
Locus Z1481
Protein AAG55602.1
unknown protein encoded by bacteriophage BP-933W
Escherichia coli O157:H7 str. EDL933
Length 153 aa, Gene n/a, UniProt n/a
>AAG55602.1|Escherichia coli O157:H7 str. EDL933|unknown protein encoded by bacteriophage BP-933W
MSEKIAVVYIGPKPVKKDTITGSRTLFPRLEPVHVDSAMAWQLLGFPDVWVRHEELDDVLKKQQQNEQLRQAQQAQERVLAALAEAENSFVVSVNGQEVDLSKLTSARLATLCEAEELDIHKDPKETAEAFRIRVREAFRRRVAETEQHGGTE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,367,460 | -4.68 | 0.049 | ●●○○○ -1.61 | -1.611427163932798 | 21278291 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)