Bacterial taxon 155864
Locus Z6025
Protein AAK16941.1
unknown protein encoded by cryptic prophage CP-933P
Escherichia coli O157:H7 str. EDL933
Length 176 aa, Gene n/a, UniProt n/a
>AAK16941.1|Escherichia coli O157:H7 str. EDL933|unknown protein encoded by cryptic prophage CP-933P
MNVLRAQVASSGRGEFTLGNETVSIVFNETDGRFLSSGSSGGLLTELFLYGFNNGPEALRDRMLSMLSDSGEAQSQESIQDKISQCKFPVSSGNFQCPPESIQCPITLERPEEGVFVKNSDSSAVCCLFDFDAFSRLASEGSYHPLTREPITASMIISPDKCVYDPIKGNFIIKDS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,286,059 | -0.34 | 0.17 | ○○○○○ 0.33 | 0.3333757103297367 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,286,454 | 1.12 | 0.11 | ○○○○○ 0.98 | 0.9841083505407036 | 21278291 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)