Bacterial taxon 155864
Locus Z4315
Protein AAG58100.1
unknown protein encoded by ISEc8
Escherichia coli O157:H7 str. EDL933
Length 224 aa, Gene n/a, UniProt n/a
>AAG58100.1|Escherichia coli O157:H7 str. EDL933|unknown protein encoded by ISEc8
MNSQTKKDIPCFRSYLPDALRLRFEDKLTIRAIAQRLGLSHSTIHTLFQRFIASGIAWPLPDSVSLAQLDAILYANRKKELTEPQISEGTWRKERRTSYSREFKIRLVKQALQPGAVVARIAREHGINDNLLLKWKSQYEDGLLSDDDIQECMPVPVALTDTPEPTRPVTNPFWRNKPDECPESDPGNVPRCELHLKSGVVKLFDPLTPEMLRALIREMKGGTR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 3,922,332 | -0.91 | 0.18 | ○○○○○ 0.08 | 0.07785073581434362 | 21278291 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)