Bacterial taxon 155864
Locus Z2077
Protein AAG56147.1
unknown protein encoded by prophage CP-933O
Escherichia coli O157:H7 str. EDL933
Length 215 aa, Gene n/a, UniProt n/a
>AAG56147.1|Escherichia coli O157:H7 str. EDL933|unknown protein encoded by prophage CP-933O
MPIFLNFTAGSILPENELASLRYIVQQNQNDTVIIKERYKMDIRYIESVNGFTVNPVCSNHFSIFMARQNTIARNLEQQINNGRSFAQISQDFMLQLSSNIGWKKGAENALKNKIHSHSFVVNPDEFSCDTQFLKCPITLCVPEKGVFVKNALNSNICTLYDKSAFMNLTREHLPHPLSREKIVKEMIIERNMCYFDTISQHFIIMDADQQETAL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,874,353 | -1.33 | 0.18 | ●○○○○ -0.11 | -0.11210572123644706 | 21278291 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)