Bacterial taxon 155864
Locus Z2973
Protein AAG56905.1
unknown protein encoded by prophage CP-933T
Escherichia coli O157:H7 str. EDL933
Length 80 aa, Gene n/a, UniProt n/a
>AAG56905.1|Escherichia coli O157:H7 str. EDL933|unknown protein encoded by prophage CP-933T
MGKEYKTLINKAPERFYFRLSASGAHAERAARDSLTRAIRSLYDVAFYADDLDALNELSELICAAECGEHIEPYKLGNIA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,672,185 | -2.12 | 0.16 | ●○○○○ -0.47 | -0.46626185722298735 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,672,048 | 1.36 | 0.098 | ○○○○○ 1.1 | 1.0951010561735968 | 21278291 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)