Bacterial taxon 155864
Locus Z2974
Protein AAG56906.1
unknown protein encoded by prophage CP-933T
Escherichia coli O157:H7 str. EDL933
Length 138 aa, Gene n/a, UniProt n/a
>AAG56906.1|Escherichia coli O157:H7 str. EDL933|unknown protein encoded by prophage CP-933T
MNAKEKNIINTLKIVSAEQDKLSRAAQKDNQHMAALYALTIAIATPEAAKVIEEQSKEIDTLKTQSTVAAMNPSSIGRCIYILGSAMMLQYTIIAELHGKYLITPYHTKESELLTNLRLIERSQAVFIDDAQRAVFNA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,672,464 | 0.87 | 0.12 | ○○○○○ 0.87 | 0.8726072729350892 | 21278291 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)