Bacterial taxon 155864
Locus Z2368
Protein AAG56414.1
unknown protein encoded within prophage CP-933R
Escherichia coli O157:H7 str. EDL933
Length 46 aa, Gene n/a, UniProt n/a
>AAG56414.1|Escherichia coli O157:H7 str. EDL933|unknown protein encoded within prophage CP-933R
MAKNDFCDKYFEYYLQINEVVRMDGNITIEYEVYVRIVWAEKAKTR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,139,415 | 0.43 | 0.14 | ○○○○○ 0.68 | 0.6769569099968684 | 21278291 |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,139,408 | 1.6 | 0.087 | ○○○○○ 1.2 | 1.2019211323079433 | 21278291 |
Retrieved 2 of 2 entries in 1.1 ms
(Link to these results)