Bacterial taxon 71421
Locus HI_1615
Protein NP_439757.1
5-(carboxyamino)imidazole ribonucleotide mutase
Haemophilus influenzae Rd KW20
Length 164 aa, Gene purE, UniProt P43849
>NP_439757.1|Haemophilus influenzae Rd KW20|5-(carboxyamino)imidazole ribonucleotide mutase
MSKTAQIAVVMGSKSDWATMQEATQILDELNVPYHVEVVSAHRTPDKLFEFAENAQKNGYKVIIAGAGGAAHLPGMIAAKTLVPVLGVPVKSSMLSGVDSLYSIVQMPKGIPVGTLAIGPAGAANAGLLAAQILAGWDDALFTRLQAFRENQTNMVLDNPDPRT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.89 | 0.034 | ●●●○○ -2.14 | -2.135523623251962 | 19805314 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)