Bacterial taxon 71421
Locus HI_0544
Protein NP_438702.1
50S ribosomal protein L9
Haemophilus influenzae Rd KW20
Length 149 aa, Gene rplI, UniProt P44349
>NP_438702.1|Haemophilus influenzae Rd KW20|50S ribosomal protein L9
MQVILLDKIVHLGQVGDQVNVKSGFARNFLIPQGKAVMATKANIEHFEARRAELEATAAANLAAAQARAAEVTALGSVTIASKAGDEGRLFGAITTRDVAEAVTAAGVKIAKSEVRLPNGPIRTLGDHDVRFQLHGEVFAALDVIVVAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.68 | 0.05 | ●●○○○ -1.96 | -1.955131227380827 | 19805314 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)