Bacterial taxon 71421
Locus HI_1301
Protein NP_439452.1
carbonic anhydrase
Haemophilus influenzae Rd KW20
Length 229 aa, Gene can, UniProt P45148
>NP_439452.1|Haemophilus influenzae Rd KW20|carbonic anhydrase
MDKIKQLFANNYSWAQRMKEENSTYFKELADHQTPHYLWIGCSDSRVPAEKLTNLEPGELFVHRNVANQVIHTDFNCLSVVQYAVDVLKIEHIIICGHTNCGGIHAAMADKDLGLINNWLLHIRDIWFKHGHLLGKLSPEKRADMLTKINVAEQVYNLGRTSIVKSAWERGQKLSLHGWVYDVNDGFLVDQGVMATSRETLEISYRNAIARLSILDEENILKKDHLENT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -3.68 | 0.0068 | ●●●○○ -2.8 | -2.795186005009862 | 19805314 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)