Bacterial taxon 71421
Locus HI_1397
Protein NP_439550.1
DNA polymerase III subunit chi
Haemophilus influenzae Rd KW20
Length 144 aa, Gene holC, UniProt P43749
>NP_439550.1|Haemophilus influenzae Rd KW20|DNA polymerase III subunit chi
MAKTAQFYILTENCTLTVEEIACNLAASIWRSGKKVLISCESEAQALEIDERLWQRDPNEFVPHNLSGEATQYPTPIEISWLGKRNLQRRDLLINLQQEIPDFSHSFTQIIDFVPKDDALKTQARERYKQLRLQGWNLSTENVG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.97 | 0.03 | ●●●○○ -2.2 | -2.1983326443106983 | 19805314 |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)