Bacterial taxon 71421
Locus HI_0328
Protein NP_438492.3
elongation factor P
Haemophilus influenzae Rd KW20
Length 188 aa, Gene efp, UniProt P43771
>NP_438492.3|Haemophilus influenzae Rd KW20|elongation factor P
MATYTTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRKLISGKVLDVNFKSGTSVEAADVMDLNLTYSYKDDAFWYFMHPETFEQYSADAKAVGDAEKWLLDQADCIVTLWNGAPITVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVKVPLFVQIGEVIRVDTRSGEYVSRVK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -2.97 | 0.03 | ●●●○○ -2.2 | -2.1983326443106983 | 19805314 |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)