Bacterial taxon 71421
Locus HI_0743
Protein NP_438902.1
preprotein translocase subunit SecB
Haemophilus influenzae Rd KW20
Length 169 aa, Gene secB, UniProt P44853
>NP_438902.1|Haemophilus influenzae Rd KW20|preprotein translocase subunit SecB
MSEQKQDVAATEEQQPVLQIQRIYVKDVSFEAPNLPHIFQQEWKPKLGFDLSTETTQVGDDLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMAHCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAEEKSEEEQTKH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 2.26 | 0.03 | ○○○○○ 2.2 | 2.1966151966003564 | 19805314 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)