Bacterial taxon 71421
Locus HI_0039
Protein NP_438212.1
rod shape-determining protein MreD
Haemophilus influenzae Rd KW20
Length 162 aa, Gene mreD, UniProt P44476
>NP_438212.1|Haemophilus influenzae Rd KW20|rod shape-determining protein MreD
MQTRFILQWFTILSFFVIAFVLELAPWPVGFQMLKPAWLVLVLLYWVLAIPNKVSIGWSFLLGLTWDLILGSTLGVHALVLSTSMYIIAKNYLILRNLSLWFQSLLVVLFVFIIRLLIFLVEFSLHTAFFHWQAILGAFASGLLWPWVFLLMRKIRRKVKLH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -4.44 | 0.00092 | ●●●●○ -3.43 | -3.4343100428470628 | 19805314 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)