Bacterial taxon 1308539
Locus VK055_3328
Protein AIK81885.1
16S rRNA (guanine(527)-N(7))-methyltransferase GidB
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 207 aa, Gene n/a, UniProt n/a
>AIK81885.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|16S rRNA (guanine(527)-N(7))-methyltransferase GidB
MLNKLSRLLDEAGISLTDHQKNQLVAYVGLLDKWNKAYNLTSVRDPNEMLVRHILDSIIVAPYLQGSRFIDVGTGPGLPGIPLAIVCPESHFTLLDSLGKRVRFLRQVQHELKLDNVTPVQSRVEAFPAEPPFDGVISRAFASLNDMVSWCHHLPAANGHFYALKGLAQKEEMESLPEGYDIVEVIELHVPRLEGERHLVVIKPKSS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.59 | 7.6e-7 | ●○○○○ -0.11 | -0.11114050547770156 | 26060277 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)