Bacterial taxon 1308539
Locus VK055_2874
Protein AIK81463.1
3-keto-L-gulonate 6-phosphate decarboxylase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 212 aa, Gene n/a, UniProt n/a
>AIK81463.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|3-keto-L-gulonate 6-phosphate decarboxylase
MLQVALDNQTLASAYETTRLIAEEVDIIEVGTILCVGEGVRAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKEFNGDVQIELTGFWTWEQAQAWREAGIQQVVYHRSRDAQAAGVAWSEADISAIKRLSDMGFKVTVTGGLALEDLPLFAGIPVHVFIAGRSIRDAASPVEAARQFKRSIAQLWG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | 0.71 | 2.2e-6 | ○○○○○ 0.59 | 0.5886153278989112 | 26060277 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)