Bacterial taxon 1308539
Locus VK055_2468
Protein AIK81065.1
8-oxo-dGTPase
Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Length 130 aa, Gene n/a, UniProt n/a
>AIK81065.1|Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1|8-oxo-dGTPase
MKKLQIAVGIIRNPQGEIFITQRAADAHMANKLEFPGGKIESDETPEQALIRELQEEVGITVTTSSLFDKLEYQFPDRHITLWFFLVESWQGEPWGKEGQPGRWMAGPTLDPAAFPPANEPVISKLIAQG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus C57BL/6) | lung | BTO:0000763 | 24 h | not available in this study | -0.29 | 0.0043 | ○○○○○ 0.05 | 0.05471840341650995 | 26060277 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)